Lineage for d3ztna_ (3ztn A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2775473Fold b.19: Viral protein domain [49817] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll; form trimers
  4. 2775474Superfamily b.19.1: Viral protein domain [49818] (4 families) (S)
    forms homotrimers
  5. 2775521Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins)
  6. 2776025Protein automated matches [190291] (19 species)
    not a true protein
  7. 2776134Species Influenza A virus [TaxId:641501] [256167] (2 PDB entries)
  8. 2776135Domain d3ztna_: 3ztn A: [250842]
    Other proteins in same PDB: d3ztnb_, d3ztnl1
    automated match to d1rd8a_
    complexed with gol, nag, so4

Details for d3ztna_

PDB Entry: 3ztn (more details), 3 Å

PDB Description: structure of influenza a neutralizing antibody selected from cultures of single human plasma cells in complex with human h1 influenza haemagglutinin.
PDB Compounds: (A:) Haemagglutinin

SCOPe Domain Sequences for d3ztna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ztna_ b.19.1.2 (A:) automated matches {Influenza A virus [TaxId: 641501]}
dtlcigyhannstdtvdtvleknvtvthsvnlledkhngklcklrgvaplhlgkcniagw
ilgnpeceslstasswsyivetpssdngtcypgdfidyeelreqlssvssferfeifpkt
sswpnhdsnkgvtaacphagaksfyknliwlvkkgnsypklsksyindkgkevlvlwgih
hpstsadqqslyqnadtyvfvgssryskkfkpeiairpkvrdqegrmnyywtlvepgdki
tfeatgnlvvpryafamernagsgiiisdtpvhdcnttcqtpkgaintslpfqnihpiti
gkcpkyvkstklrlatglrnipsiqsr

SCOPe Domain Coordinates for d3ztna_:

Click to download the PDB-style file with coordinates for d3ztna_.
(The format of our PDB-style files is described here.)

Timeline for d3ztna_: