Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
Protein automated matches [190056] (147 species) not a true protein |
Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries) |
Domain d3ztlj_: 3ztl J: [250841] automated match to d2i81b_ |
PDB Entry: 3ztl (more details), 3 Å
SCOPe Domain Sequences for d3ztlj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ztlj_ c.47.1.0 (J:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} tmvllpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvcpteiiafsdqv eefnsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeed gnafrglfiidpngilrqitindkpvgrsvdetlrlldafqfvekhgevcpvnwkrgqhg ikv
Timeline for d3ztlj_: