Lineage for d3zsfh_ (3zsf H:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163903Species Neisseria gonorrhoeae [TaxId:485] [255703] (2 PDB entries)
  8. 2163912Domain d3zsfh_: 3zsf H: [250831]
    automated match to d3vv5b_

Details for d3zsfh_

PDB Entry: 3zsf (more details), 2.32 Å

PDB Description: Crystal structure of the L-cystine solute receptor of Neisseria gonorrhoeae in the unliganded open conformation
PDB Compounds: (H:) abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d3zsfh_:

Sequence, based on SEQRES records: (download)

>d3zsfh_ c.94.1.0 (H:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
sgslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqw
dsmmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgv
ktaqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpnag
vkivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

Sequence, based on observed residues (ATOM records): (download)

>d3zsfh_ c.94.1.0 (H:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
sgslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqw
dsmmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgv
ktaqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpnvk
ivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

SCOPe Domain Coordinates for d3zsfh_:

Click to download the PDB-style file with coordinates for d3zsfh_.
(The format of our PDB-style files is described here.)

Timeline for d3zsfh_: