Lineage for d3zsfg_ (3zsf G:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163903Species Neisseria gonorrhoeae [TaxId:485] [255703] (2 PDB entries)
  8. 2163911Domain d3zsfg_: 3zsf G: [250830]
    automated match to d3vv5b_

Details for d3zsfg_

PDB Entry: 3zsf (more details), 2.32 Å

PDB Description: Crystal structure of the L-cystine solute receptor of Neisseria gonorrhoeae in the unliganded open conformation
PDB Compounds: (G:) abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d3zsfg_:

Sequence, based on SEQRES records: (download)

>d3zsfg_ c.94.1.0 (G:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
gslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqwd
smmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgvk
taqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpnagv
kivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

Sequence, based on observed residues (ATOM records): (download)

>d3zsfg_ c.94.1.0 (G:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
gslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqwd
smmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgvk
taqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpgvki
vwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

SCOPe Domain Coordinates for d3zsfg_:

Click to download the PDB-style file with coordinates for d3zsfg_.
(The format of our PDB-style files is described here.)

Timeline for d3zsfg_: