SCOPe 2.04: Domain d3zsff_: 3zsf F:

Lineage for d3zsff_ (3zsf F:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (87 species)
   not a true protein

7. Species Neisseria gonorrhoeae [TaxId:485] [255703] (2 PDB entries)

8. Domain d3zsff_: 3zsf F: [250829]
   automated match to d3vv5b_

Details for d3zsff_

PDB Entry: 3zsf, 2.32 Å

PDB Description: Crystal structure of the L-cystine solute receptor of Neisseria gonorrhoeae in the unliganded open conformation

PDB Compounds: (F:) abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d3zsff_:

Sequence; same for both SEQRES and ATOM records:

>d3zsff_ c.94.1.0 (F:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
sgslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqw
dsmmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgv
ktaqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpnag
vkivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

Timeline for d3zsff_:

• d3zsff_ is new in SCOPe 2.04-stable
  
• d3zsff_ appears in SCOPe 2.05
  
• d3zsff_ appears in the current release, SCOPe 2.08