SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3zsff_ (3zsf F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2144291Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2144292Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2145531Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2145532Protein automated matches [190039] (130 species)
    not a true protein
  7. 2145904Species Neisseria gonorrhoeae [TaxId:485] [255703] (2 PDB entries)
  8. 2145911Domain d3zsff_: 3zsf F: [250829]
    automated match to d3vv5b_

Details for d3zsff_

PDB Entry: 3zsf (more details), 2.32 Å

PDB Description: Crystal structure of the L-cystine solute receptor of Neisseria gonorrhoeae in the unliganded open conformation
PDB Compounds: (F:) abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d3zsff_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zsff_ c.94.1.0 (F:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
sgslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqw
dsmmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgv
ktaqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpnag
vkivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

SCOPe Domain Coordinates for d3zsff_:

Click to download the PDB-style file with coordinates for d3zsff_.
(The format of our PDB-style files is described here.)

Timeline for d3zsff_: