Lineage for d3zsfe_ (3zsf E:)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2162067Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2162068Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2163419Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2163420Protein automated matches [190039] (140 species)
    not a true protein
  7. 2163903Species Neisseria gonorrhoeae [TaxId:485] [255703] (2 PDB entries)
  8. 2163909Domain d3zsfe_: 3zsf E: [250828]
    automated match to d3vv5b_

Details for d3zsfe_

PDB Entry: 3zsf (more details), 2.32 Å

PDB Description: Crystal structure of the L-cystine solute receptor of Neisseria gonorrhoeae in the unliganded open conformation
PDB Compounds: (E:) abc transporter, periplasmic binding protein, amino acid

SCOPe Domain Sequences for d3zsfe_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zsfe_ c.94.1.0 (E:) automated matches {Neisseria gonorrhoeae [TaxId: 485]}
gslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqwd
smmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgvk
taqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpnagv
kivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq

SCOPe Domain Coordinates for d3zsfe_:

Click to download the PDB-style file with coordinates for d3zsfe_.
(The format of our PDB-style files is described here.)

Timeline for d3zsfe_: