Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (87 species) not a true protein |
Species Neisseria gonorrhoeae [TaxId:485] [255703] (2 PDB entries) |
Domain d3zsfc_: 3zsf C: [250826] automated match to d3vv5b_ |
PDB Entry: 3zsf (more details), 2.32 Å
SCOPe Domain Sequences for d3zsfc_:
Sequence, based on SEQRES records: (download)
>d3zsfc_ c.94.1.0 (C:) automated matches {Neisseria gonorrhoeae [TaxId: 485]} gslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqwd smmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgvk taqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpnagv kivwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq
>d3zsfc_ c.94.1.0 (C:) automated matches {Neisseria gonorrhoeae [TaxId: 485]} gslierinnkgtvtvgtegtyapftyhdkdgkltgydvevtravaeklgvkvefketqwd smmaglkagrfdvvanqvgltsperqatfdksepyswsgavlvahndsniksiadikgvk taqsltsnygekakaagaqlvpvdglaqsltlieqkradatlndelavldylkknpgvki vwsapadekvgsglivnkgndeavakfstainelkadgtlkklgeqffgkdisvq
Timeline for d3zsfc_: