Lineage for d3zrsa2 (3zrs A:139-294)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2032114Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2032891Family b.1.18.16: Cytoplasmic domain of inward rectifier potassium channel [81966] (4 protein domains)
  6. 2032909Protein automated matches [190782] (2 species)
    not a true protein
  7. 2032910Species Magnetospirillum magnetotacticum [TaxId:188] [229112] (4 PDB entries)
  8. 2032912Domain d3zrsa2: 3zrs A:139-294 [250823]
    Other proteins in same PDB: d3zrsa1, d3zrsa3
    automated match to d2wlka2
    complexed with cl, k

Details for d3zrsa2

PDB Entry: 3zrs (more details), 3.05 Å

PDB Description: X-ray crystal structure of a KirBac potassium channel highlights a mechanism of channel opening at the bundle-crossing gate.
PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d3zrsa2:

Sequence, based on SEQRES records: (download)

>d3zrsa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttlpdgrraldlgkfheia

Sequence, based on observed residues (ATOM records): (download)

>d3zrsa2 b.1.18.16 (A:139-294) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
tagvlfssrmvisdfegkptlmmrlanlrieqiieadvhlvlvrseisqegmvfrrfhdl
tltrsrspifslswtvmhpidhhspiygetdetlrnshseflvlftghheafaqnvharh
ayscdeiiwgghfvdvfttgrraldlgkfheia

SCOPe Domain Coordinates for d3zrsa2:

Click to download the PDB-style file with coordinates for d3zrsa2.
(The format of our PDB-style files is described here.)

Timeline for d3zrsa2: