SCOPe 2.05: Domain d3zrsa1: 3zrs A:12-138

Lineage for d3zrsa1 (3zrs A:12-138)

1. Root: SCOPe 2.05

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
   oligomeric transmembrane alpha-helical proteins

4. Superfamily f.14.1: Voltage-gated potassium channels [81324] (2 families)

5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)

6. Protein automated matches [190184] (3 species)
   not a true protein

7. Species Magnetospirillum magnetotacticum [TaxId:188] [229110] (4 PDB entries)

8. Domain d3zrsa1: 3zrs A:12-138 [250822]
   Other proteins in same PDB: d3zrsa2
   automated match to d2wlka1
   complexed with cl, k

Details for d3zrsa1

PDB Entry: 3zrs, 3.05 Å

PDB Description: X-ray crystal structure of a KirBac potassium channel highlights a mechanism of channel opening at the bundle-crossing gate.

PDB Compounds: (A:) ATP-sensitive inward rectifier potassium channel 10

SCOPe Domain Sequences for d3zrsa1:

Sequence, based on SEQRES records:

>d3zrsa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlglekrgwlddhyhdlltvswpvfitlitglylvtnalfalaylac
gdvienarpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarli
yarftrp

Sequence, based on observed residues (ATOM records):

>d3zrsa1 f.14.1.1 (A:12-138) automated matches {Magnetospirillum magnetotacticum [TaxId: 188]}
prilnsdgssnitrlwlddhyhdlltvswpvfitlitglylvtnalfalaylacgdvien
arpgsftdafffsvqtmatigygklipigplantlvtlealcgmlglavaarliyarftr
p

Timeline for d3zrsa1:

• d3zrsa1 first appeared in SCOPe 2.04
  
• d3zrsa1 appears in SCOPe 2.06
  
• d3zrsa1 appears in the current release, SCOPe 2.08