Class b: All beta proteins [48724] (177 folds) |
Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily) barrel, closed; n=8, S=10; one overside connection |
Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) automatically mapped to Pfam PF03734 |
Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins) Pfam PF03734; ErfK/YbiS/YcfS/YnhG |
Protein automated matches [234004] (2 species) not a true protein |
Species Bacillus subtilis [TaxId:224308] [256166] (2 PDB entries) |
Domain d3zqda2: 3zqd A:52-167 [250818] Other proteins in same PDB: d3zqda1, d3zqda3, d3zqda4 automated match to d1y7ma1 |
PDB Entry: 3zqd (more details)
SCOPe Domain Sequences for d3zqda2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zqda2 b.160.1.1 (A:52-167) automated matches {Bacillus subtilis [TaxId: 224308]} pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf gaywlslskqhygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr
Timeline for d3zqda2: