Lineage for d3zqda2 (3zqd A:52-167)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2089357Fold b.160: L,D-transpeptidase catalytic domain-like [141522] (1 superfamily)
    barrel, closed; n=8, S=10; one overside connection
  4. 2089358Superfamily b.160.1: L,D-transpeptidase catalytic domain-like [141523] (1 family) (S)
    automatically mapped to Pfam PF03734
  5. 2089359Family b.160.1.1: L,D-transpeptidase catalytic domain-like [141524] (3 proteins)
    Pfam PF03734; ErfK/YbiS/YcfS/YnhG
  6. 2089370Protein automated matches [234004] (2 species)
    not a true protein
  7. 2089383Species Bacillus subtilis [TaxId:224308] [256166] (2 PDB entries)
  8. 2089384Domain d3zqda2: 3zqd A:52-167 [250818]
    Other proteins in same PDB: d3zqda1, d3zqda3, d3zqda4
    automated match to d1y7ma1

Details for d3zqda2

PDB Entry: 3zqd (more details)

PDB Description: b. subtilis l,d-transpeptidase
PDB Compounds: (A:) l, d-transpeptidase ykud

SCOPe Domain Sequences for d3zqda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zqda2 b.160.1.1 (A:52-167) automated matches {Bacillus subtilis [TaxId: 224308]}
pdpytipyhiavsigaktltlslnnrvmktypiavgkiltqtptgefyiinrqrnpggpf
gaywlslskqhygihgtnnpasigkavskgcirmhnkdvielasivpngtrvtinr

SCOPe Domain Coordinates for d3zqda2:

Click to download the PDB-style file with coordinates for d3zqda2.
(The format of our PDB-style files is described here.)

Timeline for d3zqda2: