Lineage for d3zq5a3 (3zq5 A:327-514)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2970038Fold d.110: Profilin-like [55769] (10 superfamilies)
    core: 2 alpha-helices and 5-stranded antiparallel sheet: order 21543; 3 layers: alpha/beta/alpha
  4. 2970135Superfamily d.110.2: GAF domain-like [55781] (5 families) (S)
    alpha(2)-beta(3)-alpha-beta(3)-alpha; antiparallel beta-sheet: order 321654
  5. 2970256Family d.110.2.0: automated matches [191507] (1 protein)
    not a true family
  6. 2970257Protein automated matches [190838] (19 species)
    not a true protein
  7. 2970320Species Synechocystis sp. [TaxId:1148] [256164] (1 PDB entry)
  8. 2970322Domain d3zq5a3: 3zq5 A:327-514 [250816]
    Other proteins in same PDB: d3zq5a1, d3zq5a4
    automated match to d2veaa2
    complexed with act, cyc, gol, na, po4; mutant

Details for d3zq5a3

PDB Entry: 3zq5 (more details), 1.95 Å

PDB Description: structure of the y263f mutant of the cyanobacterial phytochrome cph1
PDB Compounds: (A:) phytochrome-like protein cph1

SCOPe Domain Sequences for d3zq5a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zq5a3 d.110.2.0 (A:327-514) automated matches {Synechocystis sp. [TaxId: 1148]}
yrvqlaeheavlldkmttaadfvegltnhpdrllgltgsqgaaicfgeklilvgetpdek
avqyllqwlenrevqdvfftsslsqiypdavnfksvasgllaipiarhnfllwfrpevlq
tvnwggdpnhayeatqedgkielhprqsfdlwkeivrlqslpwqsveiqsalalkkaivn
lilrqaee

SCOPe Domain Coordinates for d3zq5a3:

Click to download the PDB-style file with coordinates for d3zq5a3.
(The format of our PDB-style files is described here.)

Timeline for d3zq5a3: