Lineage for d3zpda_ (3zpd A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1771693Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 1771869Superfamily b.2.3: Bacterial adhesins [49401] (7 families) (S)
  5. 1771874Family b.2.3.2: Pilus subunits [49405] (9 proteins)
  6. 1771891Protein Mannose-specific adhesin FimH [49406] (2 species)
    duplication: consists of two domains of this fold; C-terminal domain lacks the last strand
  7. 1771892Species Escherichia coli [TaxId:562] [49407] (23 PDB entries)
  8. 1771977Domain d3zpda_: 3zpd A: [250811]
    automated match to d4atta_

Details for d3zpda_

PDB Entry: 3zpd (more details)

PDB Description: Solution structure of the FimH adhesin carbohydrate-binding domain
PDB Compounds: (A:) FimH

SCOPe Domain Sequences for d3zpda_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zpda_ b.2.3.2 (A:) Mannose-specific adhesin FimH {Escherichia coli [TaxId: 562]}
facktangtaipigggsanvyvnlapvvnvgqnlvvdlstqifchndypetitdyvtlqr
gsayggvlsnfsgtvkysgssypfpttsetprvvynsrtdkpwpvalyltpvssaggvai
kagsliavlilrqtnnynsddfqfvwniyanndvvvpt

SCOPe Domain Coordinates for d3zpda_:

Click to download the PDB-style file with coordinates for d3zpda_.
(The format of our PDB-style files is described here.)

Timeline for d3zpda_: