Lineage for d3zoba1 (3zob A:6-65)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2691778Superfamily a.4.1: Homeodomain-like [46689] (21 families) (S)
    consists only of helices
  5. 2692712Family a.4.1.0: automated matches [191447] (1 protein)
    not a true family
  6. 2692713Protein automated matches [190674] (25 species)
    not a true protein
  7. 2692750Species Chicken (Gallus gallus) [TaxId:9031] [256162] (1 PDB entry)
  8. 2692751Domain d3zoba1: 3zob A:6-65 [250810]
    Other proteins in same PDB: d3zoba2, d3zoba3
    automated match to d1qrya_

Details for d3zoba1

PDB Entry: 3zob (more details)

PDB Description: Solution structure of chicken Engrailed 2 homeodomain
PDB Compounds: (A:) homeobox protein engrailed-2

SCOPe Domain Sequences for d3zoba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zoba1 a.4.1.0 (A:6-65) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
dkrprtaftaeqlqrlkaefqtnrylteqrrqslaqelglnesqikiwfqnkrakikkat

SCOPe Domain Coordinates for d3zoba1:

Click to download the PDB-style file with coordinates for d3zoba1.
(The format of our PDB-style files is described here.)

Timeline for d3zoba1: