Lineage for d3zl5j_ (3zl5 J:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1852416Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1852417Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1854430Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1854431Protein automated matches [190056] (147 species)
    not a true protein
  7. 1854635Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)
  8. 1854652Domain d3zl5j_: 3zl5 J: [250807]
    automated match to d2i81b_
    complexed with peg, so4; mutant

Details for d3zl5j_

PDB Entry: 3zl5 (more details), 2.49 Å

PDB Description: Crystal structure of Schistosoma mansoni Peroxiredoxin I C48S mutant with one decamer in the ASU
PDB Compounds: (J:) peroxiredoxin I

SCOPe Domain Sequences for d3zl5j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zl5j_ c.47.1.0 (J:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mvllpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvspteiiafsdqve
efnsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeedg
nafrglfiidpngilrqitindkpvgrsvdetlrlldafqfvek

SCOPe Domain Coordinates for d3zl5j_:

Click to download the PDB-style file with coordinates for d3zl5j_.
(The format of our PDB-style files is described here.)

Timeline for d3zl5j_: