Lineage for d3zl5f_ (3zl5 F:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2484063Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2484064Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2486890Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2486891Protein automated matches [190056] (188 species)
    not a true protein
  7. 2487138Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)
  8. 2487151Domain d3zl5f_: 3zl5 F: [250803]
    automated match to d2i81b_
    complexed with peg, so4; mutant

Details for d3zl5f_

PDB Entry: 3zl5 (more details), 2.49 Å

PDB Description: Crystal structure of Schistosoma mansoni Peroxiredoxin I C48S mutant with one decamer in the ASU
PDB Compounds: (F:) peroxiredoxin I

SCOPe Domain Sequences for d3zl5f_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zl5f_ c.47.1.0 (F:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
mvllpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvspteiiafsdqve
efnsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeedg
nafrglfiidpngilrqitindkpvgrsvdetlrlldafqfve

SCOPe Domain Coordinates for d3zl5f_:

Click to download the PDB-style file with coordinates for d3zl5f_.
(The format of our PDB-style files is described here.)

Timeline for d3zl5f_: