Lineage for d3zl5a_ (3zl5 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1600407Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 1600408Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 1602360Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 1602361Protein automated matches [190056] (133 species)
    not a true protein
  7. 1602527Species Blood fluke (Schistosoma mansoni) [TaxId:6183] [189028] (9 PDB entries)
  8. 1602535Domain d3zl5a_: 3zl5 A: [250798]
    automated match to d2i81b_
    complexed with peg, so4; mutant

Details for d3zl5a_

PDB Entry: 3zl5 (more details), 2.49 Å

PDB Description: Crystal structure of Schistosoma mansoni Peroxiredoxin I C48S mutant with one decamer in the ASU
PDB Compounds: (A:) peroxiredoxin I

SCOPe Domain Sequences for d3zl5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zl5a_ c.47.1.0 (A:) automated matches {Blood fluke (Schistosoma mansoni) [TaxId: 6183]}
llpnrpapefkgqavingefkeiclkdyrgkyvvlffypadftfvspteiiafsdqveef
nsrncqviacstdsqyshlawdnldrksgglghmkiplladrkqeiskaygvfdeedgna
frglfiidpngilrqitindkpvgrsvdetlrlldafqfvek

SCOPe Domain Coordinates for d3zl5a_:

Click to download the PDB-style file with coordinates for d3zl5a_.
(The format of our PDB-style files is described here.)

Timeline for d3zl5a_: