Lineage for d3zj8b_ (3zj8 B:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2081496Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2083716Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2083717Protein automated matches [190075] (90 species)
    not a true protein
  7. 2084128Species Rauvolfia serpentina [TaxId:4060] [189830] (12 PDB entries)
  8. 2084152Domain d3zj8b_: 3zj8 B: [250797]
    automated match to d1hxjb_
    complexed with lr1

Details for d3zj8b_

PDB Entry: 3zj8 (more details), 3.01 Å

PDB Description: crystal structure of strictosidine glucosidase in complex with inhibitor-2
PDB Compounds: (B:) strictosidine-o-beta-d-glucosidase

SCOPe Domain Sequences for d3zj8b_:

Sequence, based on SEQRES records: (download)

>d3zj8b_ c.1.8.0 (B:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
vhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincyh
mykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikpsv
tlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngya
lgefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmwm
eplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgcy
dfigmnyytatyvtnavksnseklsyetddqvtktfernqkpighalyggwqhvvpwgly
kllvytketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgv
nvkgyfvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiagk

Sequence, based on observed residues (ATOM records): (download)

>d3zj8b_ c.1.8.0 (B:) automated matches {Rauvolfia serpentina [TaxId: 4060]}
vhrrdfpqdfifgaggsayqcegaynegnrgpsiwdtftqrspakisdgsngnqaincyh
mykedikimkqtglesyrfsiswsrvlpggrlaagvnkdgvkfyhdfidellangikpsv
tlfhwdlpqaledeyggflshrivddfceyaefcfwefgdkikywttfnephtfavngya
lgefapgrggkgdegdpaiepyvvthnillahkaaveeyrnkfqkcqegeigivlnsmwm
eplsdvqadidaqkraldfmlgwfleplttgdypksmrelvkgrlpkfsaddseklkgcy
dfigmnyytatyvtnavklsyetddqvtktfernqkpighalyggwqhvvpwglykllvy
tketyhvpvlyvtesgmveenktkillsearrdaertdyhqkhlasvrdaiddgvnvkgy
fvwsffdnfewnlgyicrygiihvdyksferypkesaiwyknfiagk

SCOPe Domain Coordinates for d3zj8b_:

Click to download the PDB-style file with coordinates for d3zj8b_.
(The format of our PDB-style files is described here.)

Timeline for d3zj8b_: