SCOPe 2.08: Domain d3zfzb3: 3zfz B:328-668

Lineage for d3zfzb3 (3zfz B:328-668)

1. Root: SCOPe 2.08

2. Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein automated matches [190161] (29 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:158878] [256157] (6 PDB entries)

8. Domain d3zfzb3: 3zfz B:328-668 [250778]
   Other proteins in same PDB: d3zfza1, d3zfza2, d3zfzb1, d3zfzb2
   automated match to d1vqqa3
   complexed with 1w8, ai8, cd, cl, mur

Details for d3zfzb3

PDB Entry: 3zfz, 2.25 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by soaking

PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zfzb3:

Sequence; same for both SEQRES and ATOM records:

>d3zfzb3 e.3.1.1 (B:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

Timeline for d3zfzb3:

• d3zfzb3 first appeared in SCOPe 2.04
  
• d3zfzb3 appears in SCOPe 2.07