Lineage for d3zfzb3 (3zfz B:328-668)

  1. Root: SCOPe 2.08
  2. 3012399Class e: Multi-domain proteins (alpha and beta) [56572] (74 folds)
  3. 3012718Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
    contains a cluster of helices and an alpha+beta sandwich
  4. 3012719Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) (S)
  5. 3012720Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)
    in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
  6. 3013567Protein automated matches [190161] (29 species)
    not a true protein
  7. 3013965Species Staphylococcus aureus [TaxId:158878] [256157] (6 PDB entries)
  8. 3013969Domain d3zfzb3: 3zfz B:328-668 [250778]
    Other proteins in same PDB: d3zfza1, d3zfza2, d3zfzb1, d3zfzb2
    automated match to d1vqqa3
    complexed with 1w8, ai8, cd, cl, mur

Details for d3zfzb3

PDB Entry: 3zfz (more details), 2.25 Å

PDB Description: crystal structure of ceftaroline acyl-pbp2a from mrsa with non- covalently bound ceftaroline and muramic acid at allosteric site obtained by soaking
PDB Compounds: (B:) penicillin binding protein 2 prime

SCOPe Domain Sequences for d3zfzb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zfzb3 e.3.1.1 (B:328-668) automated matches {Staphylococcus aureus [TaxId: 158878]}
idakvqksiynnmkndygsgtaihpqtgellalvstpsydvypfmygmsneeynkltedk
kepllnkfqittspgstqkiltamiglnnktlddktsykidgkgwqkdkswggynvtrye
vvngnidlkqaiessdniffarvalelgskkfekgmkklgvgedipsdypfynaqisnkn
ldneilladsgygqgeilinpvqilsiysalenngninaphllkdtknkvwkkniisken
inlltdgmqqvvnkthkediyrsyanligksgtaelkmkqgetgrqigwfisydkdnpnm
mmainvkdvqdkgmasynakisgkvydelyengnkkydide

SCOPe Domain Coordinates for d3zfzb3:

Click to download the PDB-style file with coordinates for d3zfzb3.
(The format of our PDB-style files is described here.)

Timeline for d3zfzb3: