![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.17: Cystatin-like [54402] (7 superfamilies) Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet |
![]() | Superfamily d.17.4: NTF2-like [54427] (31 families) ![]() has a beta-alpha(2)-beta insertion after the main helix |
![]() | Family d.17.4.0: automated matches [191337] (1 protein) not a true family |
![]() | Protein automated matches [190205] (35 species) not a true protein |
![]() | Species Staphylococcus aureus [TaxId:158878] [256155] (6 PDB entries) |
![]() | Domain d3zfzb1: 3zfz B:27-138 [250776] Other proteins in same PDB: d3zfza2, d3zfza3, d3zfzb2, d3zfzb3 automated match to d1vqqa1 complexed with 1w8, ai8, cd, cl, mur |
PDB Entry: 3zfz (more details), 2.25 Å
SCOPe Domain Sequences for d3zfzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zfzb1 d.17.4.0 (B:27-138) automated matches {Staphylococcus aureus [TaxId: 158878]} dkeinntidaiedknfkqvykdssyisksdngevemterpikiynslgvkdiniqdrkik kvsknkkrvdaqykiktnygnidrnvqfnfvkedgmwkldwdhsviipgmqk
Timeline for d3zfzb1: