Lineage for d3zf3a_ (3zf3 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1560503Fold b.85: beta-clip [51268] (7 superfamilies)
    double-stranded ribbon sharply bent in two places; the ribbon ends form incomplete barrel; jelly-roll
  4. 1560650Superfamily b.85.4: dUTPase-like [51283] (2 families) (S)
    forms tight trimer through an additional beta-sheet in each subunit
    subunit beta-sheets are orthogonally packed around the three-fold axis
  5. 1560843Family b.85.4.0: automated matches [191644] (1 protein)
    not a true family
  6. 1560844Protein automated matches [191182] (11 species)
    not a true protein
  7. 1561018Species Staphylococcus phage [TaxId:53369] [256154] (7 PDB entries)
  8. 1561023Domain d3zf3a_: 3zf3 A: [250770]
    automated match to d4gv8c_
    complexed with ni; mutant

Details for d3zf3a_

PDB Entry: 3zf3 (more details), 3.1 Å

PDB Description: Phage dUTPases control transfer of virulence genes by a proto-oncogenic G protein-like mechanism. (Staphylococcus bacteriophage 80alpha dUTPase Y84I mutant).
PDB Compounds: (A:) dutpase

SCOPe Domain Sequences for d3zf3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zf3a_ b.85.4.0 (A:) automated matches {Staphylococcus phage [TaxId: 53369]}
tntlqvkllsknarmpernhktdagydifsaetvvlepqekaviktdvavsipegyvgll
tsrsgvsskthlvietgkidagihgnlginikndheddkmqtiflrnidnekifekerhl
yklgsyriekgeriaqlvivpiwtpelkqveefes

SCOPe Domain Coordinates for d3zf3a_:

Click to download the PDB-style file with coordinates for d3zf3a_.
(The format of our PDB-style files is described here.)

Timeline for d3zf3a_: