Lineage for d3zbyf1 (3zby F:2-401)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004931Fold a.104: Cytochrome P450 [48263] (1 superfamily)
    multihelical
  4. 2004932Superfamily a.104.1: Cytochrome P450 [48264] (2 families) (S)
  5. 2005528Family a.104.1.0: automated matches [191509] (1 protein)
    not a true family
  6. 2005529Protein automated matches [190847] (63 species)
    not a true protein
  7. 2005724Species Mycobacterium smegmatis [TaxId:246196] [231662] (5 PDB entries)
  8. 2005734Domain d3zbyf1: 3zby F:2-401 [250758]
    Other proteins in same PDB: d3zbya2, d3zbyb2, d3zbyc2, d3zbyd2, d3zbye2, d3zbyf2
    automated match to d2yooa_
    complexed with bcd, edo, hem, so4

Details for d3zbyf1

PDB Entry: 3zby (more details), 1.93 Å

PDB Description: Ligand-free structure of CYP142 from Mycobacterium smegmatis
PDB Compounds: (F:) p450 heme-thiolate protein

SCOPe Domain Sequences for d3zbyf1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zbyf1 a.104.1.0 (F:2-401) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
tqmltrpdvdlvngmfyadggareayrwmranepvfrdrnglaaattyqavldaernpel
fsstggirpdqpgmpymidmddpqhllrrklvnagftrkrvmdkvdsigrlcdtlidavc
ergecdfvrdiaaplpmavigdmlgvlpterdmllkwsddlvcglsshvdeaaiqklmdt
faayteftkdvitkrraeptddlfsvlvnsevegqrmsddeivfetlliliggdettrht
lsggteqllrhrdqwdalvadvdllpgaieemlrwtspvknmcrtltadtvfhgtelrag
ekimlmfesanfdesvfgdpdnfridrnpnshvafgfgthfclgnqlarlelrlmtervl
rrlpdlrladdapvplrpanfvsgpesmpvvftpsapvla

SCOPe Domain Coordinates for d3zbyf1:

Click to download the PDB-style file with coordinates for d3zbyf1.
(The format of our PDB-style files is described here.)

Timeline for d3zbyf1: