![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
![]() | Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
![]() | Family b.29.1.1: Legume lectins [49900] (5 proteins) |
![]() | Protein automated matches [190035] (28 species) not a true protein |
![]() | Species French bean (Phaseolus vulgaris) [TaxId:3885] [238518] (3 PDB entries) |
![]() | Domain d3wogb_: 3wog B: [250752] automated match to d3wcrb_ complexed with ca, mn, nag |
PDB Entry: 3wog (more details), 2 Å
SCOPe Domain Sequences for d3wogb_:
Sequence, based on SEQRES records: (download)
>d3wogb_ b.29.1.1 (B:) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} asqtsfsfqrfnetnlilqrdatvsskgqlrltnvndngeptlsslgrafysapiqiwdn ttgavasfatsftfnidvpnnsgpadglafvllpvgsqpkdkggllglfnnykydsnaht vavefdtlynvhwdpkprhigidvnsiksiktttwdfvkgenaevlitydsstkllvasl vypslktsfivsdtvdlksvlpewvivgftattgitkgnvetndilswsfasklsdgtts ealnlanfal
>d3wogb_ b.29.1.1 (B:) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]} asqtsfsfqrfnetnlilqrdatvsskgqlrltnvndngeptlsslgrafysapiqiwdn ttgavasfatsftfnidvpnnsgpadglafvllpvgsqpkdkggllglfnnykydsnaht vavefdtlynvhwdpkprhigidvnsiksiktttwdfvkgenaevlitydsstkllvasl vypslktsfivsdtvdlksvlpewvivgftattgitkgnvetndilswsfasklslnlan fal
Timeline for d3wogb_: