SCOPe 2.08: Domain d3woga_: 3wog A:

Lineage for d3woga_ (3wog A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.1: Legume lectins [49900] (5 proteins)

6. Protein automated matches [190035] (28 species)
   not a true protein

7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [238518] (3 PDB entries)

8. Domain d3woga_: 3wog A: [250751]
   automated match to d3wcsa_
   complexed with ca, mn, nag

Details for d3woga_

PDB Entry: 3wog, 2 Å

PDB Description: crystal structure plant lectin in complex with ligand

PDB Compounds: (A:) Erythroagglutinin

SCOPe Domain Sequences for d3woga_:

Sequence; same for both SEQRES and ATOM records:

>d3woga_ b.29.1.1 (A:) automated matches {French bean (Phaseolus vulgaris) [TaxId: 3885]}
asqtsfsfqrfnetnlilqrdatvsskgqlrltnvndngeptlsslgrafysapiqiwdn
ttgavasfatsftfnidvpnnsgpadglafvllpvgsqpkdkggllglfnnykydsnaht
vavefdtlynvhwdpkprhigidvnsiksiktttwdfvkgenaevlitydsstkllvasl
vypslktsfivsdtvdlksvlpewvivgftattgitkgnvetndilswsfasklsdgt

Timeline for d3woga_:

• d3woga_ first appeared in SCOPe 2.04
  
• d3woga_ appears in SCOPe 2.07