Lineage for d3wfva1 (3wfv A:546-623)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3040824Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies)
    core: trimeric coiled coil
  4. 3042053Superfamily h.3.2: Virus ectodomain [58069] (2 families) (S)
  5. 3042054Family h.3.2.1: Virus ectodomain [58070] (9 proteins)
  6. 3042100Protein Retrovius gp41 protease-resistant core [58071] (4 species)
    coiled coil; biological unit: trimer
  7. 3042101Species Human immunodeficiency virus type 1 [TaxId:11676] [58072] (26 PDB entries)
  8. 3042117Domain d3wfva1: 3wfv A:546-623 [250746]
    Other proteins in same PDB: d3wfva2
    automated match to d1f23b_

Details for d3wfva1

PDB Entry: 3wfv (more details), 1.8 Å

PDB Description: hiv-1 crf07 gp41
PDB Compounds: (A:) envelope glycoprotein gp160

SCOPe Domain Sequences for d3wfva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wfva1 h.3.2.1 (A:546-623) Retrovius gp41 protease-resistant core {Human immunodeficiency virus type 1 [TaxId: 11676]}
sgivqqqsnllraieaqqhllqltvwgikqlqtrvlggggrwmqwdkeisnytntvyrll
eesqnqqernekdllala

SCOPe Domain Coordinates for d3wfva1:

Click to download the PDB-style file with coordinates for d3wfva1.
(The format of our PDB-style files is described here.)

Timeline for d3wfva1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wfva2