Lineage for d3weba_ (3web A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2766140Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 2766141Protein automated matches [190226] (81 species)
    not a true protein
  7. 2766172Species Camponotus japonicus [TaxId:84547] [236657] (2 PDB entries)
  8. 2766173Domain d3weba_: 3web A: [250745]
    automated match to d3weab_
    complexed with ola

Details for d3weba_

PDB Entry: 3web (more details), 1.7 Å

PDB Description: crystal structure of a niemann-pick type c2 protein from japanese carpenter ant in complex with oleic acid
PDB Compounds: (A:) Niemann-Pick type C2 protein

SCOPe Domain Sequences for d3weba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3weba_ b.1.18.0 (A:) automated matches {Camponotus japonicus [TaxId: 84547]}
fvfedcgsevgkfsdiiisscdpseekcsiireseihvsmkftpsvdvknveakafgvll
dvpvpfplkkpeickdpdsgvkcplkkdveieykvtffvekatpalsleimwefrnekde
kitcvkfpakik

SCOPe Domain Coordinates for d3weba_:

Click to download the PDB-style file with coordinates for d3weba_.
(The format of our PDB-style files is described here.)

Timeline for d3weba_: