SCOPe 2.04: Domain d3wdga_: 3wdg A:

Lineage for d3wdga_ (3wdg A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.18: Uracil-DNA glycosylase-like [52140] (1 superfamily)
   3 layers, a/b/a; core: parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.18.1: Uracil-DNA glycosylase-like [52141] (5 families)

5. Family c.18.1.0: automated matches [193165] (1 protein)
   not a true family

6. Protein automated matches [193166] (5 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:282458] [236655] (2 PDB entries)

8. Domain d3wdga_: 3wdg A: [250744]
   automated match to d3wdfa_
   protein/DNA complex

Details for d3wdga_

PDB Entry: 3wdg, 2.2 Å

PDB Description: Staphylococcus aureus UDG / UGI complex

PDB Compounds: (A:) uracil-DNA glycosylase

SCOPe Domain Sequences for d3wdga_:

Sequence; same for both SEQRES and ATOM records:

>d3wdga_ c.18.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 282458]}
mewsqifhdittkhdfkamhdflekeystaivypdreniyqafdltpfenikvvilgqdp
yhgpnqahglafsvqpnakfppslrnmykeladdigcvrqtphlqdwaregvlllntvlt
vrqgeanshrdigwetftdeiikavsdykehvvfilwgkpaqqkiklidtskhciiksvh
psplsayrgffgskpyskantylesvgkspinwces

Timeline for d3wdga_:

• d3wdga_ is new in SCOPe 2.04-stable
  
• d3wdga_ appears in SCOPe 2.05
  
• d3wdga_ appears in the current release, SCOPe 2.08