SCOPe 2.04: Domain d3wd5l2: 3wd5 L:107-213

Lineage for d3wd5l2 (3wd5 L:107-213)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries)

8. Domain d3wd5l2: 3wd5 L:107-213 [250743]
   Other proteins in same PDB: d3wd5a_, d3wd5l1
   automated match to d4hcrl2

Details for d3wd5l2

PDB Entry: 3wd5, 3.1 Å

PDB Description: crystal structure of tnfalpha in complex with adalimumab fab fragment

PDB Compounds: (L:) Adalimumab Light Chain

SCOPe Domain Sequences for d3wd5l2:

Sequence; same for both SEQRES and ATOM records:

>d3wd5l2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d3wd5l2:

• d3wd5l2 is new in SCOPe 2.04-stable
  
• d3wd5l2 appears in SCOPe 2.05
  
• d3wd5l2 appears in the current release, SCOPe 2.08