| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (9 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (385 PDB entries) |
| Domain d3wd5l2: 3wd5 L:107-213 [250743] Other proteins in same PDB: d3wd5a_, d3wd5l1 automated match to d4hcrl2 |
PDB Entry: 3wd5 (more details), 3.1 Å
SCOPe Domain Sequences for d3wd5l2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wd5l2 b.1.1.2 (L:107-213) automated matches {Human (Homo sapiens) [TaxId: 9606]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge
Timeline for d3wd5l2: