Lineage for d3wc3a_ (3wc3 A:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1498423Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1498424Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 1498646Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 1498647Protein automated matches [190108] (10 species)
    not a true protein
  7. 1498682Species Worm (Eisenia fetida) [TaxId:6396] [256152] (1 PDB entry)
  8. 1498683Domain d3wc3a_: 3wc3 A: [250740]
    automated match to d1ks8a_
    complexed with ca, flc, gol, na, trs

Details for d3wc3a_

PDB Entry: 3wc3 (more details), 1.5 Å

PDB Description: crystal structure of endo-1,4-beta-glucanase from eisenia fetida
PDB Compounds: (A:) Endo-1, 4-beta-glucanase

SCOPe Domain Sequences for d3wc3a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wc3a_ a.102.1.0 (A:) automated matches {Worm (Eisenia fetida) [TaxId: 6396]}
fqynydevleksilfyeaersgdlpannripyrgdsalgdqgnqgqdltggwydagdhvk
fgfpmafatttlawgilefrdgyeaagqynlaldsirwtlnyflkahvsdnefygqvgda
ntdhaywgrpedmtmerpawsispsapgsdlaaetaaalaagylvfrdsdaafannllah
srtlydfalnnrgiysqsisnaagfyassayedelawgaawlyrateeqeyldrayefgt
ttntawaydwnekivgyqlllttsagqtdflprvenflrnwfpggsvqytplglawlaqw
gpnryaanaafialvsakynilaseseqfarsqihymlgdagrsyvvgfgnnppqqphhr
ssscpdqpaecdwdefnqpgpnyqilygalvggpdqndqfedlrsdyirnevandynagf
qgavaalraiqlrdg

SCOPe Domain Coordinates for d3wc3a_:

Click to download the PDB-style file with coordinates for d3wc3a_.
(The format of our PDB-style files is described here.)

Timeline for d3wc3a_: