Lineage for d3wc3a1 (3wc3 A:22-455)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2004058Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 2004059Superfamily a.102.1: Six-hairpin glycosidases [48208] (10 families) (S)
  5. 2004283Family a.102.1.0: automated matches [191318] (1 protein)
    not a true family
  6. 2004284Protein automated matches [190108] (16 species)
    not a true protein
  7. 2004323Species Worm (Eisenia fetida) [TaxId:6396] [256152] (1 PDB entry)
  8. 2004324Domain d3wc3a1: 3wc3 A:22-455 [250740]
    Other proteins in same PDB: d3wc3a2
    automated match to d1ks8a_
    complexed with ca, flc, gol, na, trs

Details for d3wc3a1

PDB Entry: 3wc3 (more details), 1.5 Å

PDB Description: crystal structure of endo-1,4-beta-glucanase from eisenia fetida
PDB Compounds: (A:) Endo-1, 4-beta-glucanase

SCOPe Domain Sequences for d3wc3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wc3a1 a.102.1.0 (A:22-455) automated matches {Worm (Eisenia fetida) [TaxId: 6396]}
qynydevleksilfyeaersgdlpannripyrgdsalgdqgnqgqdltggwydagdhvkf
gfpmafatttlawgilefrdgyeaagqynlaldsirwtlnyflkahvsdnefygqvgdan
tdhaywgrpedmtmerpawsispsapgsdlaaetaaalaagylvfrdsdaafannllahs
rtlydfalnnrgiysqsisnaagfyassayedelawgaawlyrateeqeyldrayefgtt
tntawaydwnekivgyqlllttsagqtdflprvenflrnwfpggsvqytplglawlaqwg
pnryaanaafialvsakynilaseseqfarsqihymlgdagrsyvvgfgnnppqqphhrs
sscpdqpaecdwdefnqpgpnyqilygalvggpdqndqfedlrsdyirnevandynagfq
gavaalraiqlrdg

SCOPe Domain Coordinates for d3wc3a1:

Click to download the PDB-style file with coordinates for d3wc3a1.
(The format of our PDB-style files is described here.)

Timeline for d3wc3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3wc3a2