Lineage for d3wa9c_ (3wa9 C:)

  1. Root: SCOPe 2.04
  2. 1473060Class a: All alpha proteins [46456] (285 folds)
  3. 1482597Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1482598Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1482599Family a.22.1.1: Nucleosome core histones [47114] (6 proteins)
    form octamers composed of two copies of each of the four histones
  6. 1483034Protein automated matches [193445] (6 species)
    not a true protein
  7. 1483056Species Human (Homo sapiens) [TaxId:9606] [193446] (25 PDB entries)
  8. 1483153Domain d3wa9c_: 3wa9 C: [250734]
    automated match to d1id3c_
    protein/DNA complex

Details for d3wa9c_

PDB Entry: 3wa9 (more details), 3.07 Å

PDB Description: The nucleosome containing human H2A.Z.1
PDB Compounds: (C:) histone h2a.z

SCOPe Domain Sequences for d3wa9c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wa9c_ a.22.1.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
kavsrsqraglqfpvgrihrhlksrttshgrvgataavysaaileyltaevlelagnask
dlkvkritprhlqlairgdeeldslikatiagggviphihksligk

SCOPe Domain Coordinates for d3wa9c_:

Click to download the PDB-style file with coordinates for d3wa9c_.
(The format of our PDB-style files is described here.)

Timeline for d3wa9c_: