SCOPe 2.06: Domain d3w95a1: 3w95 A:1-146

Lineage for d3w95a1 (3w95 A:1-146)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.0: automated matches [191364] (1 protein)
   not a true family

6. Protein automated matches [190438] (24 species)
   not a true protein

7. Species Human enterovirus 71 [TaxId:103922] [256150] (1 PDB entry)

8. Domain d3w95a1: 3w95 A:1-146 [250732]
   Other proteins in same PDB: d3w95a2
   automated match to d4mg3b_
   complexed with zn

Details for d3w95a1

PDB Entry: 3w95, 1.85 Å

PDB Description: Crystal structure of 2A proteinase (C110A) from enterovirus 71

PDB Compounds: (A:) Genome polyprotein

SCOPe Domain Sequences for d3w95a1:

Sequence; same for both SEQRES and ATOM records:

>d3w95a1 b.47.1.0 (A:1-146) automated matches {Human enterovirus 71 [TaxId: 103922]}
gkfgqqsgaiyvgnfrvvnrhlathndwanlvwedssrdllvssttaqgcdtiarcncqt
gvyycnsrrkhypvsfskpsliyveaseyyparyqshlmlaqghsepgdaggilrcqhgv
vgivstggnglvgfadvrdllwldee

Timeline for d3w95a1:

• d3w95a1 first appeared in SCOPe 2.04, called d3w95a_
  
• d3w95a1 was called d3w95a_ in SCOPe 2.05
  
• d3w95a1 appears in SCOPe 2.07
  
• d3w95a1 appears in the current release, SCOPe 2.08