Lineage for d3w7vb_ (3w7v B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1586636Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1588097Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 1588207Family c.23.10.0: automated matches [191588] (1 protein)
    not a true family
  6. 1588208Protein automated matches [191059] (10 species)
    not a true protein
  7. 1588223Species Geobacillus stearothermophilus [TaxId:1422] [236728] (5 PDB entries)
  8. 1588229Domain d3w7vb_: 3w7v B: [250731]
    automated match to d4jhla_
    complexed with cl, gol

Details for d3w7vb_

PDB Entry: 3w7v (more details), 1.85 Å

PDB Description: crystal structure of axe2, an acetylxylan esterase from geobacillus stearothermophilus
PDB Compounds: (B:) acetyl xylan esterase

SCOPe Domain Sequences for d3w7vb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w7vb_ c.23.10.0 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdsitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalawdrvhpsvaghmilaraflreigfewvrsr

SCOPe Domain Coordinates for d3w7vb_:

Click to download the PDB-style file with coordinates for d3w7vb_.
(The format of our PDB-style files is described here.)

Timeline for d3w7vb_: