SCOPe 2.04: Domain d3w7va_: 3w7v A:

Lineage for d3w7va_ (3w7v A:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.0: automated matches [191588] (1 protein)
   not a true family

6. Protein automated matches [191059] (10 species)
   not a true protein

7. Species Geobacillus stearothermophilus [TaxId:1422] [236728] (5 PDB entries)

8. Domain d3w7va_: 3w7v A: [250730]
   automated match to d4jhla_
   complexed with cl, gol

Details for d3w7va_

PDB Entry: 3w7v, 1.85 Å

PDB Description: crystal structure of axe2, an acetylxylan esterase from geobacillus stearothermophilus

PDB Compounds: (A:) acetyl xylan esterase

SCOPe Domain Sequences for d3w7va_:

Sequence; same for both SEQRES and ATOM records:

>d3w7va_ c.23.10.0 (A:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mkigsgekllfigdsitdcgrarpegegsfgalgtgyvayvvgllqavypelgirvvnkg
isgntvrdlkarweedviaqkpdwvsimigindvwrqydlpfmkekhvyldeyeatlrsl
vletkplvkgiilmtpfyiegneqdpmrrtmdqygrvvkqiaeetnslfvdtqaafnevl
ktlypaalawdrvhpsvaghmilaraflreigfewvrsr

Timeline for d3w7va_:

• d3w7va_ is new in SCOPe 2.04-stable
  
• d3w7va_ appears in SCOPe 2.05
  
• d3w7va_ appears in the current release, SCOPe 2.08