![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.100: 6-phosphogluconate dehydrogenase C-terminal domain-like [48178] (1 superfamily) multihelical; common core is formed around two long antiparallel helices related by (pseudo) twofold symmetry |
![]() | Superfamily a.100.1: 6-phosphogluconate dehydrogenase C-terminal domain-like [48179] (13 families) ![]() N-terminal domain is Rossmann-fold with a family-specific C-terminal extension |
![]() | Family a.100.1.0: automated matches [227147] (1 protein) not a true family |
![]() | Protein automated matches [226851] (46 species) not a true protein |
![]() | Species Pyrobaculum calidifontis [TaxId:410359] [236095] (4 PDB entries) |
![]() | Domain d3w6za2: 3w6z A:162-283 [250729] Other proteins in same PDB: d3w6za1, d3w6za3 automated match to d3w6ua2 complexed with nap |
PDB Entry: 3w6z (more details), 1.44 Å
SCOPe Domain Sequences for d3w6za2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w6za2 a.100.1.0 (A:162-283) automated matches {Pyrobaculum calidifontis [TaxId: 410359]} pvgygqammlvnqvvvalntvamveglklakalgldmdkvaevltrgaarsgaielylpk llkgdlspgfkaehlkkdlgyvleearkrgvklpgaelayelyrkmvedgagslgihalg fy
Timeline for d3w6za2: