Lineage for d3w1zd_ (3w1z D:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1776751Fold b.15: HSP20-like chaperones [49763] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
  4. 1776752Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) (S)
  5. 1776847Family b.15.1.0: automated matches [191643] (1 protein)
    not a true family
  6. 1776848Protein automated matches [191181] (5 species)
    not a true protein
  7. 1776855Species Schizosaccharomyces pombe [TaxId:284812] [256147] (1 PDB entry)
  8. 1776856Domain d3w1zd_: 3w1z D: [250723]
    automated match to d4i88b_

Details for d3w1zd_

PDB Entry: 3w1z (more details), 2.4 Å

PDB Description: Heat shock protein 16.0 from Schizosaccharomyces pombe
PDB Compounds: (D:) Heat shock protein 16

SCOPe Domain Sequences for d3w1zd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3w1zd_ b.15.1.0 (D:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
elspsidvhegkdtvsvdvelpgvkkedvqvhydsgkltisgevvnerknestegnqrws
errfgsfsrtitipakidadrieanfsnglltvtlpkveksqtkkqiaik

SCOPe Domain Coordinates for d3w1zd_:

Click to download the PDB-style file with coordinates for d3w1zd_.
(The format of our PDB-style files is described here.)

Timeline for d3w1zd_: