| Class b: All beta proteins [48724] (176 folds) |
| Fold b.15: HSP20-like chaperones [49763] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key |
Superfamily b.15.1: HSP20-like chaperones [49764] (5 families) ![]() |
| Family b.15.1.0: automated matches [191643] (1 protein) not a true family |
| Protein automated matches [191181] (4 species) not a true protein |
| Species Schizosaccharomyces pombe [TaxId:284812] [256147] (1 PDB entry) |
| Domain d3w1zd_: 3w1z D: [250723] automated match to d4i88b_ |
PDB Entry: 3w1z (more details), 2.4 Å
SCOPe Domain Sequences for d3w1zd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3w1zd_ b.15.1.0 (D:) automated matches {Schizosaccharomyces pombe [TaxId: 284812]}
elspsidvhegkdtvsvdvelpgvkkedvqvhydsgkltisgevvnerknestegnqrws
errfgsfsrtitipakidadrieanfsnglltvtlpkveksqtkkqiaik
Timeline for d3w1zd_: