Lineage for d3vyca_ (3vyc A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2006336Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2006337Superfamily a.118.1: ARM repeat [48371] (26 families) (S)
  5. 2006908Family a.118.1.0: automated matches [191340] (1 protein)
    not a true family
  6. 2006909Protein automated matches [190220] (14 species)
    not a true protein
  7. 2006931Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:559292] [256146] (2 PDB entries)
  8. 2006932Domain d3vyca_: 3vyc A: [250720]
    automated match to d3gb8a_

Details for d3vyca_

PDB Entry: 3vyc (more details), 2.1 Å

PDB Description: Crystal structure of unliganded Saccharomyces cerevisiae CRM1 (Xpo1p)
PDB Compounds: (A:) Exportin-1

SCOPe Domain Sequences for d3vyca_:

Sequence, based on SEQRES records: (download)

>d3vyca_ a.118.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
awqkadqilqfstnpqskfialsildklitrkwkllpndhrigirnfvvgmiismcqdde
vfktqknlinksdltlvqilkqewpqnwpefipeligsssssvnvcennmivlkllseev
fdfsaeqmtqakalhlknsmskefeqifklcfqvleqgsssslivatlesllrylhwipy
ryiyetnilellstkfmtspdtraitlkcltevsnlkipqdndlikrqtvlffqntlqqi
atsvmpvtadlkatyanangndqsflqdlamflttylarnrallesdeslrelllnahqy
liqlskieerelfkttldywhnlvadlfyeplkkhiyeeicsqlrlviienmvrpeevlv
vendegeivrefvkesdtiqlykserevlvylthlnvidteeimisklarqidgsewswh
nintlswaigsisgtmsedtekrfvvtvikdlldltvkkrgkdnkavvasdimyvvgqyp
rflkahwnflrtvilklfefmhethegvqdmacdtfikivqkckyhfviqqpresepfiq
tiirdiqkttadlqpqqvhtfykacgiiiseersvaernrllsdlmqlpnmawdtiveqs
tanptllldsetvkiianiiktnvavctsmgadfypqlghiyynmlqlyravssmisaqv
aaegliatktpkvrglrtikkeilklvetyiskarnlddvvkvlvepllnavledymnnv
pdardaevlncmttvvekvghmipqgvililqsvfectldminkdfteypehrvefykll
kvineksfaaflelppaafklfvdaicwafkhnnrdvevnglqialdlvkniermgnvpf
anefhknyffifvsetffvltdsdhksgfskqalllmklislvydnktsnqvylsqylan
mlsnafphltseqiasflsaltkqykdlvvfkgtlrdflvqikevggdptdylfaedken
almeqnrlerekaakiggllkpseldd

Sequence, based on observed residues (ATOM records): (download)

>d3vyca_ a.118.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 559292]}
awqkadqilqkfialsildklitrkwkllpndhrigirnfvvgmiismcqddevfktqkn
linksdltlvqilkqewpqnwpefipeligsssssvnvcennmivlkllseevfdfsaeq
mtqakalhlknsmskefeqifklcfqvleqgsssslivatlesllrylhwipyryiyetn
ilellstkfmtspdtraitlkcltevsnlkiikrqtvlffqntlqqiatsvmpvtadlka
tyanangndqsflqdlamflttylarnrallesdeslrelllnahqyliqlskieerelf
kttldywhnlvadlfyeplkkhiyeeicsqlrlviienmvrpeevlvvendegeivrefv
kesdtiqlykserevlvylthlnvidteeimisklarqidgsewswhnintlswaigsis
gtmsedtekrfvvtvikdlldltvkkrgkdnkavvasdimyvvgqyprflkahwnflrtv
ilklfefmhethegvqdmacdtfikivqkckyhfviqqpresepfiqtiirdiqkttadl
qpqqvhtfykacgiiiseersvaernrllsdlmqlpnmawdtiveqstanptllldsetv
kiianiiktnvavctsmgadfypqlghiyynmlqlyravssmisaqvaaegliatktpkv
rglrtikkeilklvetyiskarnlddvvkvlvepllnavledymnnvpdardaevlncmt
tvvekvghmipqgvililqsvfectldminkdfteypehrvefykllkvineksfaafle
lppaafklfvdaicwafkhnnrdvevnglqialdlvkniermgnvpfanefhknyffifv
setffvltdsdhksgfskqalllmklislvydnktsnqvylsqylanmlsnafphltseq
iasflsaltkqykdlvvfkgtlrdflvqikevggdptdylfaedkenalmeqnrlereka
akiggllkpseldd

SCOPe Domain Coordinates for d3vyca_:

Click to download the PDB-style file with coordinates for d3vyca_.
(The format of our PDB-style files is described here.)

Timeline for d3vyca_: