SCOPe 2.04: Domain d3vwjd2: 3vwj D:119-246

Lineage for d3vwjd2 (3vwj D:119-246)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d3vwjd2: 3vwj D:119-246 [250717]
   Other proteins in same PDB: d3vwja1, d3vwjb_, d3vwjc2
   automated match to d3q5ya2
   complexed with db3, mg, nag

Details for d3vwjd2

PDB Entry: 3vwj, 3.09 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-c20:2 complex

PDB Compounds: (D:) NKT15 T cell receptor beta-chain

SCOPe Domain Sequences for d3vwjd2:

Sequence, based on SEQRES records:

>d3vwjd2 b.1.1.0 (D:119-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

Sequence, based on observed residues (ATOM records):

>d3vwjd2 b.1.1.0 (D:119-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvnkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgra

Timeline for d3vwjd2:

• d3vwjd2 is new in SCOPe 2.04-stable
  
• d3vwjd2 appears in SCOPe 2.05
  
• d3vwjd2 appears in the current release, SCOPe 2.08