SCOPe 2.05: Domain d3vwjc2: 3vwj C:118-206

Lineage for d3vwjc2 (3vwj C:118-206)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d3vwjc2: 3vwj C:118-206 [250715]
   Other proteins in same PDB: d3vwja1, d3vwja2, d3vwjb_, d3vwjc1, d3vwjd1, d3vwjd2
   automated match to d2pyfa2
   complexed with db3, mg, nag

Details for d3vwjc2

PDB Entry: 3vwj, 3.09 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-c20:2 complex

PDB Compounds: (C:) NKT15 T cell receptor alpha-chain

SCOPe Domain Sequences for d3vwjc2:

Sequence, based on SEQRES records:

>d3vwjc2 b.1.1.2 (C:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3vwjc2 b.1.1.2 (C:118-206) automated matches {Human (Homo sapiens) [TaxId: 9606]}
inpdpavyqlrdssvclftdfdsqtnvsqsksdvyitdkcvldmrsmdfksnsavawsdf
acanafnnsiipedtffps

Timeline for d3vwjc2:

• d3vwjc2 first appeared in SCOPe 2.04
  
• d3vwjc2 appears in SCOPe 2.06
  
• d3vwjc2 appears in the current release, SCOPe 2.08