SCOPe 2.05: Domain d3vwja2: 3vwj A:184-278

Lineage for d3vwja2 (3vwj A:184-278)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (558 PDB entries)

8. Domain d3vwja2: 3vwj A:184-278 [250712]
   Other proteins in same PDB: d3vwja1, d3vwjb_, d3vwjc2
   automated match to d3hujc2
   complexed with db3, mg, nag

Details for d3vwja2

PDB Entry: 3vwj, 3.09 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-c20:2 complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3vwja2:

Sequence, based on SEQRES records:

>d3vwja2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywh

Sequence, based on observed residues (ATOM records):

>d3vwja2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgrlllvchvsgfypkpvwvkwmeqqgtqpgdilpnadetwylratl
dvscrvkhsslegqdivlywh

Timeline for d3vwja2:

• d3vwja2 first appeared in SCOPe 2.04
  
• d3vwja2 appears in SCOPe 2.06
  
• d3vwja2 appears in the current release, SCOPe 2.08