Lineage for d3vwja2 (3vwj A:184-278)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1519111Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1519112Protein automated matches [190740] (19 species)
    not a true protein
  7. 1519212Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)
  8. 1520293Domain d3vwja2: 3vwj A:184-278 [250712]
    Other proteins in same PDB: d3vwja1, d3vwjb_, d3vwjc2
    automated match to d3hujc2
    complexed with db3, mg, nag

Details for d3vwja2

PDB Entry: 3vwj (more details), 3.09 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-c20:2 complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3vwja2:

Sequence, based on SEQRES records: (download)

>d3vwja2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgpgrlllvchvsgfypkpvwvkwmrgeqeqqgtqpgdilpnadetw
ylratldvvageaaglscrvkhsslegqdivlywh

Sequence, based on observed residues (ATOM records): (download)

>d3vwja2 b.1.1.0 (A:184-278) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qvkpkawlsrgpspgrlllvchvsgfypkpvwvkwmeqqgtqpgdilpnadetwylratl
dvscrvkhsslegqdivlywh

SCOPe Domain Coordinates for d3vwja2:

Click to download the PDB-style file with coordinates for d3vwja2.
(The format of our PDB-style files is described here.)

Timeline for d3vwja2: