Lineage for d3vwja1 (3vwj A:8-183)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1897191Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1897192Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1897193Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 1897194Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species)
    Class I MHC-related
  7. 1897199Species Human (Homo sapiens), CD1a [TaxId:9606] [102838] (11 PDB entries)
  8. 1897213Domain d3vwja1: 3vwj A:8-183 [250711]
    Other proteins in same PDB: d3vwja2, d3vwjb_, d3vwjc1, d3vwjc2, d3vwjd1, d3vwjd2
    automated match to d3hujc1
    complexed with db3, mg, nag

Details for d3vwja1

PDB Entry: 3vwj (more details), 3.09 Å

PDB Description: ternary crystal structure of the human nkt tcr-cd1d-c20:2 complex
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d

SCOPe Domain Sequences for d3vwja1:

Sequence, based on SEQRES records: (download)

>d3vwja1 d.19.1.1 (A:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
fplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevhpgnasnnffhvafqgkdilsfq
gtsweptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

Sequence, based on observed residues (ATOM records): (download)

>d3vwja1 d.19.1.1 (A:8-183) CD1, alpha-1 and alpha-2 domains {Human (Homo sapiens), CD1a [TaxId: 9606]}
fplrclqissfansswtrtdglawlgelqthswsndsdtvrslkpwsqgtfsdqqwetlq
hifrvyrssftrdvkefakmlrlsyplelqvsagcevsnnffhvafqgkdilsfqgtswe
ptqeaplwvnlaiqvlnqdkwtretvqwllngtcpqfvsgllesgkselkk

SCOPe Domain Coordinates for d3vwja1:

Click to download the PDB-style file with coordinates for d3vwja1.
(The format of our PDB-style files is described here.)

Timeline for d3vwja1: