Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) Similar in architecture to the superfamily I but partly differs in topology |
Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
Protein automated matches [190039] (158 species) not a true protein |
Species Thermus thermophilus [TaxId:262724] [193882] (6 PDB entries) |
Domain d3vvfa1: 3vvf A:1-236 [250703] Other proteins in same PDB: d3vvfa2, d3vvfb2 automated match to d3vv5b_ complexed with arg, so4 |
PDB Entry: 3vvf (more details), 1.9 Å
SCOPe Domain Sequences for d3vvfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vvfa1 c.94.1.0 (A:1-236) automated matches {Thermus thermophilus [TaxId: 262724]} qvrsfeeikrsgeirigtegafppfnyfdernqltgfevdlgnaiaerlglkprwiaqsf dtlliqlnqgrfdfviashgiteeraravdftnphyctggvivsrkggprtakdlqgkvv gvqvgttymeaaqkipgikevrtyqrdpdalqdllagridtwitdrfvakeaikerklen tlqvgelvfqervamavakgnkslldalnralaelmqdgtyarisqkwfgedvrck
Timeline for d3vvfa1: