SCOPe 2.08: Domain d3vveb1: 3vve B:1-236

Lineage for d3vveb1 (3vve B:1-236)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (161 species)
   not a true protein

7. Species Thermus thermophilus [TaxId:262724] [193882] (6 PDB entries)

8. Domain d3vveb1: 3vve B:1-236 [250702]
   Other proteins in same PDB: d3vvea2, d3vveb2
   automated match to d3vv5b_
   complexed with lys, so4

Details for d3vveb1

PDB Entry: 3vve, 2 Å

PDB Description: Crystal structure of TTC0807 complexed with Lysine

PDB Compounds: (B:) Amino acid ABC transporter, binding protein

SCOPe Domain Sequences for d3vveb1:

Sequence; same for both SEQRES and ATOM records:

>d3vveb1 c.94.1.0 (B:1-236) automated matches {Thermus thermophilus [TaxId: 262724]}
qvrsfeeikrsgeirigtegafppfnyfdernqltgfevdlgnaiaerlglkprwiaqsf
dtlliqlnqgrfdfviashgiteeraravdftnphyctggvivsrkggprtakdlqgkvv
gvqvgttymeaaqkipgikevrtyqrdpdalqdllagridtwitdrfvakeaikerklen
tlqvgelvfqervamavakgnkslldalnralaelmqdgtyarisqkwfgedvrck

Timeline for d3vveb1:

• d3vveb1 first appeared in SCOPe 2.04, called d3vveb_
  
• d3vveb1 appears in SCOPe 2.07