SCOPe 2.06: Domain d3vv1b_: 3vv1 B:

Lineage for d3vv1b_ (3vv1 B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (53 species)
   not a true protein

7. Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256144] (1 PDB entry)

8. Domain d3vv1b_: 3vv1 B: [250696]
   automated match to d2zhla_
   complexed with mg

Details for d3vv1b_

PDB Entry: 3vv1, 1.5 Å

PDB Description: crystal structure of caenorhabditis elegans galectin lec-6

PDB Compounds: (B:) Protein LEC-6

SCOPe Domain Sequences for d3vv1b_:

Sequence; same for both SEQRES and ATOM records:

>d3vv1b_ b.29.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gisfrneffnpqtpvnipvqgfsngarlrlvllptsadsrfhinlrtpddivlhfnarfd
egavvnnstsgggwqsedrhanpfqqnkiytlefvsnggiisifvngahfadfvertpsh
gvhlieieggvhvhsahvsh

Timeline for d3vv1b_:

• d3vv1b_ first appeared in SCOPe 2.04
  
• d3vv1b_ appears in SCOPe 2.05
  
• d3vv1b_ appears in SCOPe 2.07
  
• d3vv1b_ appears in the current release, SCOPe 2.08