Lineage for d3vv1b_ (3vv1 B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (55 species)
    not a true protein
  7. 2375557Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256144] (1 PDB entry)
  8. 2375559Domain d3vv1b_: 3vv1 B: [250696]
    automated match to d2zhla_
    complexed with mg

Details for d3vv1b_

PDB Entry: 3vv1 (more details), 1.5 Å

PDB Description: Crystal Structure of Caenorhabditis elegans galectin LEC-6
PDB Compounds: (B:) Protein LEC-6

SCOPe Domain Sequences for d3vv1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vv1b_ b.29.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gisfrneffnpqtpvnipvqgfsngarlrlvllptsadsrfhinlrtpddivlhfnarfd
egavvnnstsgggwqsedrhanpfqqnkiytlefvsnggiisifvngahfadfvertpsh
gvhlieieggvhvhsahvsh

SCOPe Domain Coordinates for d3vv1b_:

Click to download the PDB-style file with coordinates for d3vv1b_.
(The format of our PDB-style files is described here.)

Timeline for d3vv1b_: