| Class b: All beta proteins [48724] (180 folds) |
| Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) ![]() |
| Family b.29.1.0: automated matches [191363] (1 protein) not a true family |
| Protein automated matches [190437] (70 species) not a true protein |
| Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256144] (1 PDB entry) |
| Domain d3vv1b_: 3vv1 B: [250696] automated match to d2zhla_ complexed with mg |
PDB Entry: 3vv1 (more details), 1.5 Å
SCOPe Domain Sequences for d3vv1b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vv1b_ b.29.1.0 (B:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
gisfrneffnpqtpvnipvqgfsngarlrlvllptsadsrfhinlrtpddivlhfnarfd
egavvnnstsgggwqsedrhanpfqqnkiytlefvsnggiisifvngahfadfvertpsh
gvhlieieggvhvhsahvsh
Timeline for d3vv1b_: