Lineage for d3vv1a_ (3vv1 A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781211Species Nematode (Caenorhabditis elegans) [TaxId:6239] [256144] (1 PDB entry)
  8. 2781212Domain d3vv1a_: 3vv1 A: [250695]
    automated match to d2zhla_
    complexed with mg

Details for d3vv1a_

PDB Entry: 3vv1 (more details), 1.5 Å

PDB Description: crystal structure of caenorhabditis elegans galectin lec-6
PDB Compounds: (A:) Protein LEC-6

SCOPe Domain Sequences for d3vv1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vv1a_ b.29.1.0 (A:) automated matches {Nematode (Caenorhabditis elegans) [TaxId: 6239]}
igisfrneffnpqtpvnipvqgfsngarlrlvllptsadsrfhinlrtpddivlhfnarf
degavvnnstsgggwqsedrhanpfqqnkiytlefvsnggiisifvngahfadfvertps
hgvhlieieggvhvhsahvsh

SCOPe Domain Coordinates for d3vv1a_:

Click to download the PDB-style file with coordinates for d3vv1a_.
(The format of our PDB-style files is described here.)

Timeline for d3vv1a_: