![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.19: Viral protein domain [49817] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll; form trimers |
![]() | Superfamily b.19.1: Viral protein domain [49818] (4 families) ![]() forms homotrimers |
![]() | Family b.19.1.2: Influenza hemagglutinin headpiece [49823] (2 proteins) |
![]() | Protein automated matches [190291] (19 species) not a true protein |
![]() | Species Influenza A virus [TaxId:387139] [256143] (1 PDB entry) |
![]() | Domain d3vune_: 3vun E: [250693] Other proteins in same PDB: d3vunb_, d3vund_, d3vunf_ automated match to d2hmga_ complexed with nag |
PDB Entry: 3vun (more details), 3 Å
SCOPe Domain Sequences for d3vune_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vune_ b.19.1.2 (E:) automated matches {Influenza A virus [TaxId: 387139]} dnstatlclghhavpngtlvktitddqievtnatelvqssstgkicnnphrildgidctl idallgdphcdvfqnetwdlfverskafsncypydvpdyaslrslvassgtlefitegft wtgvtqnggsnackrgpssgffsrlnwltksgstypvlnvtmpnndnfdklyiwgvhhps tnqeqtslyvqasgrvtvstrrsqqtiipnigsrpwvrglssrisiywtivkpgdvlvin sngnliaprgyfkmrtgkssimrsdapidtcisecitpngsipndkpfqnvnkitygacp kyvkqntlklatgmrnvpe
Timeline for d3vune_: