![]() | Class h: Coiled coil proteins [57942] (7 folds) |
![]() | Fold h.3: Stalk segment of viral fusion proteins [58063] (3 superfamilies) core: trimeric coiled coil |
![]() | Superfamily h.3.1: Influenza hemagglutinin (stalk) [58064] (2 families) ![]() |
![]() | Family h.3.1.1: Influenza hemagglutinin (stalk) [58065] (2 proteins) |
![]() | Protein Influenza hemagglutinin (stalk) [58066] (17 species) trimer |
![]() | Species Influenza A virus, different strains [TaxId:11320] [58067] (131 PDB entries) |
![]() | Domain d3vund_: 3vun D: [250692] Other proteins in same PDB: d3vuna_, d3vunc_, d3vune_ automated match to d2viub_ complexed with nag |
PDB Entry: 3vun (more details), 3 Å
SCOPe Domain Sequences for d3vund_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3vund_ h.3.1.1 (D:) Influenza hemagglutinin (stalk) {Influenza A virus, different strains [TaxId: 11320]} glfgaiagfiengwegmidgwygfrhqnsegtgqaadlkstqaaidqingklnrviektn ekfhqiekefsevegriqdlekyvedtkidlwsynaellvalenqhtidltdsemnklfe ktrrqlrenaedmgngcfkiyhkcdnaciesirngtydhdvyrdealnnrfqi
Timeline for d3vund_: